We hope you all enjoyed the Nature Network Easter egg hunt. Thanks to everyone who took part and entered. We’re delighted to announce that the winner is Rashi Kulshrestha who was the first of several entrants who found all 20 amino acid sequences. Rashi wins a free online subscription to Nature.
The complete set of answers is given below for anyone still pulling their hair out; just click on the sequence to find where it was hidden.
1. Easy one to start. Simply find the Easter egg forum for more info and a place to discuss the challenge.
2. I am the Egg Man, but I’m profiled under my other name.
3. Look where you might eggspect to see an announcement.
4. Find the forum post about the world’s oldest bunny and you’ll get the next sequence.
5. Don’t (London) dinosaurs lay eggs? Better take a picture of that!
6. Or better yet…isn’t there a blog about a fossilised nest of eggs, and a serpentine intruder?
7. Easter lambs seem to be hidden in the Gulf Stream
8. Our blogger Dekker muses on Wordsworth’s seasonal flower
9. Hennifer Rohn wonders if GM chickens might lay chocolate eggs
10. March of the chocolate punguins by Ova Amsen
11. Heather Eggchevers delves inside a fertilised egg
12. The sheep are a-llama-ing in N’ewe York. Alpaca ‘nother pun in.
13. Do frozen chickens lay iced eggs? Check the map of Highgate, London to find out
kilelpfasgtmsmlvllpdevsgleqlesi
14. Another frigid chicken, rolled up in Cromer
15. Make no bones about it: chocolate makes for good writing as well as eating
16. In the event, Boston turned out to be a good place to hide a clue today
17. Having a Good Friday so far? Ian wasn’t.
18. The world’s most famous egg had a great fall from one of these…virtually speaking.
19. Matt Brown has some egg-cellent publications
20. Finally, fly back to the nest and see who’s tweeting.
Putting all those sequences together reveals the protein ovalbumin found in chickens’ eggs.